Inhaled VIP exerted immunoregulatory effects in patients with pulmonary sarcoidosis in a small placebo-controlled trial.
VIP (Vasoactive Intestinal Peptide)
Vasoactive intestinal peptide for immune modulation and neuroprotection

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Inhaled VIP exerted immunoregulatory effects in a small placebo-controlled trial in pulmonary sarcoidosis (2010). Older studies showed inhaled VIP causes bronchodilation and protects against histamine-induced bronchoconstriction in asthmatic subjects. Intravenous aviptadil (VIP) was tested in hospitalized COVID-19 patients; results of the ACTIV-3b/TESICO trial did not show a survival benefit.
Animal models show VIP and its analogs suppress inflammation in experimental autoimmune encephalomyelitis (a multiple sclerosis model), arthritis, and sepsis, and confer neuroprotection after ischemia.
VIP modulates macrophage and dendritic cell function, shifting immune responses toward anti-inflammatory and regulatory phenotypes in cell assays.
Broader 'anti-aging' or systemic immune-modulation claims are unproven; the neuroprotective and anti-inflammatory promise seen preclinically has not translated into approved therapies.
Key Studies & Findings
Inhaled VIP caused bronchodilation and protected against histamine-induced bronchoconstriction in asthmatic subjects.
Aviptadil (intravenous VIP) did not show a survival benefit in severely ill hospitalized COVID-19 patients in the ACTIV-3b/TESICO treatment trial.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
dosage not established
Research Protocols
CIRS protocol (Shoemaker)
- Dose
- 50mcg per spray, 4-8 sprays/day
- Frequency
- 4x daily
- Route
- Intranasal
General immune support
- Dose
- 50-100mcg
- Frequency
- 2-4x daily
- Route
- Intranasal
Starting/sensitive patients
- Dose
- 50mcg
- Frequency
- 2x daily
- Route
- Intranasal
Advanced/maintenance
- Dose
- 100-200mcg
- Frequency
- 2-4x daily
- Route
- Intranasal
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
What does VIP do in the body?
It is a neuropeptide and immunomodulator that signals through VPAC1/VPAC2 receptors: it relaxes smooth muscle (bronchodilation, vasodilation), regulates secretion, and shifts immune responses toward anti-inflammatory phenotypes.
Is VIP approved as a drug?
No. VIP (including the form known as aviptadil) is not FDA-approved; it has been studied in trials for sarcoidosis, asthma, and COVID-19 ARDS.
Why is VIP hard to use as a therapy?
It has a very short plasma half-life because enzymes rapidly degrade it, so trials use inhaled or intravenous delivery and researchers develop stabilized analogs.
Research Citations
Patrycja M Topczewska, Anna Savvopoulou, Catalina Cosovanu, Christoph S N Klose (2024)
Gozes I, Brenneman DE (1989)
Jiang W, Wang H, Li YS, Luo W (2016)
Dudai A, Yayon N, Soreq H, London M (2021)
+ 47 more citations
Related Resources
Quick Facts
Formula
C147H237N43O43S
Molecular Weight
3326.0
Sequence
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Mechanism
Anti-inflammatory and immune modulation peptide for systemic healing
Safety Information
Research compound. Very short half-life limits systemic effects. Used in localized applications.
Citations
52Patrycja M Topczewska, Anna Savvopoulou, Catalina Cosovanu, Christoph S N Klose (2024)
Gozes I, Brenneman DE (1989)
Jiang W, Wang H, Li YS, Luo W (2016)
Dudai A, Yayon N, Soreq H, London M (2021)
+ 47 more citations