Two randomized double-blind, placebo-controlled trials: nonathymulin (a synthetic thymulin analog) at 5 mg/day produced significant clinical improvement in rheumatoid arthritis (56% vs 17% placebo) with minimal adverse effects and no clear immunological changes.
Thymulin
Thymic hormone peptide for immune system maturation

🛑 WADA BANNED - Prohibited in competitive sports as immune modulating peptide
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Research compound - Thymic hormone
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Clinical studies from the 1980s-90s tested thymulin or its synthetic analog nonathymulin in rheumatoid arthritis, with mixed results: two double-blind, placebo-controlled trials found the best response at 5 mg/day (56% clinical improvement vs 17% placebo, p<0.02) but no clear changes in measured immune parameters. Zinc supplementation restored plasma zinc and thymulin activity in patients with Crohn's disease, consistent with thymulin being zinc-dependent. Circulating thymulin declines with age as the thymus involutes.
Animal studies established thymulin as a nonapeptide secreted by thymic epithelial cells that induces T-cell differentiation markers and is biologically inactive without zinc.
Laboratory assays demonstrate thymulin's effects on T-cell maturation markers, with activity requiring the zinc-bound (Zn-FTS) form.
Claims that exogenous thymulin restores immunity, reverses aging, or treats autoimmune disease in humans are not supported by modern large trials; the evidence base is old and small.
Key Studies & Findings
Zinc supplementation restored plasma concentrations of zinc and thymulin in patients with Crohn's disease.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
Research protocols: 1-5mg weekly (Research use only)
Research Protocols
Animal Research Protocol (Inflammation)
- Dose
- 15 μg/100g body weight
- Frequency
- Single dose or short course
- Route
- IP or SubQ
PAT Analog (Pain Research)
- Dose
- 25-50 μg per rat (~100-200 μg/kg)
- Frequency
- 30 min before inflammatory challenge
- Route
- IP
Anecdotal Human Protocol
- Dose
- 1-5 mg per injection
- Frequency
- Once daily for 5-10 days
- Route
- SubQ
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
What is thymulin's role in the body?
It is a thymic hormone that participates in T-cell maturation and immune regulation; its activity depends on bound zinc, and its blood levels decline with aging.
Does thymulin supplementation restore immunity?
That is not established. Historical trials (e.g., in rheumatoid arthritis) showed mixed results, and no modern large trials support immune restoration claims.
Research Citations
Goya RG, Brown OA, Pléau JM, Dardenne M (2004)
Bach JF, Dardenne M (1989)
Reggiani PC, Schwerdt JI, Console GM, Roggero EA, Dardenne M, Goya RG (2014)
Dardenne M, Saade N, Safieh-Garabedian B (2006)
Reggiani PC, Morel GR, Cónsole GM, Barbeito CG, Rodriguez SS, Brown OA, Bellini MJ, Pléau JM, Dardenne M, Goya RG (2009)
+ 20 more citations
Related Resources
Quick Facts
Formula
C33H54N12O15
Molecular Weight
0.84
Sequence
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Mechanism
Thymic hormone that regulates immune function and supports tissue repair
Safety Information
Research compound only. Limited human safety data available.
Citations
25Goya RG, Brown OA, Pléau JM, Dardenne M (2004)
Bach JF, Dardenne M (1989)
Reggiani PC, Schwerdt JI, Console GM, Roggero EA, Dardenne M, Goya RG (2014)
Dardenne M, Saade N, Safieh-Garabedian B (2006)
Reggiani PC, Morel GR, Cónsole GM, Barbeito CG, Rodriguez SS, Brown OA, Bellini MJ, Pléau JM, Dardenne M, Goya RG (2009)
+ 20 more citations