In a Phase 2 trial in adults with obesity, retatrutide (up to 12 mg weekly) produced mean weight loss up to 24.2% at 48 weeks, the largest seen for an investigational obesity agent at the time.
Retatrutide
Triple GLP-1/GIP/glucagon agonist showing exceptional weight loss potential

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Phase 3 Clinical Trials - Triple agonist
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Phase 2 (NEJM 2023, PMID 37366315) showed up to ~24% body-weight reduction at 48 weeks in adults with obesity; a Phase 2a trial in MASLD (Nat Med 2024) showed substantial liver-fat reduction and MASH resolution in many participants. Phase 3 top-line results (reported Dec 2025) showed record weight loss (~28% at highest dose) but high discontinuation rates due to gastrointestinal adverse events.
Not yet FDA-approved; long-term cardiovascular outcomes, durability, and tolerability (GI side effects, discontinuations) remain open questions as Phase 3 programs continue.
Key Studies & Findings
In a randomized Phase 2a trial in metabolic dysfunction-associated steatotic liver disease, retatrutide markedly reduced liver fat and led to MASH resolution in a large proportion of treated participants.
Phase 3 top-line results reported record weight loss (up to ~28.7% at 48 weeks) but with high discontinuation rates linked to gastrointestinal tolerability.
Benefits & Effects
Triple agonist (GLP-1
GIP
Glucagon)
Potent weight loss
Improved metabolic markers.
Triple agonist (GLP-1
GIP
Glucagon)
Potent weight loss
Improved metabolic markers.
Side Effects & Safety
Interaction
Avoid: Unknown
Interaction
Avoid: Unknown
Mild-Moderate side effect
Onset: Days
Management: Lower starting dose (2mg vs 4mg)
Dose-dependent
Mild side effect
Onset: Weeks
Management: CV monitoring
Dose-dependent
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
4-12mg weekly
Research Protocols
Conservative Starting Dose (Week 1-4)
- Dose
- 0.5 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Low Maintenance Dose (Week 4-8)
- Dose
- 1 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Standard Escalation (Week 8-12)
- Dose
- 2 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Moderate Weight Loss (Week 12-16)
- Dose
- 4 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Advanced Weight Loss (Week 16-20)
- Dose
- 8 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Maximum Efficacy (Week 20+)
- Dose
- 12 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Type 2 Diabetes - Conservative Start
- Dose
- 0.5-1 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Type 2 Diabetes - Maintenance
- Dose
- 4-8 mg weekly
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Clinical Trial Protocol (Obesity Study)
- Dose
- 1-2 mg weekly start
- Frequency
- Once weekly
- Route
- Subcutaneous injection
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is retatrutide FDA approved?
No. It remains an investigational agent in Phase 3 development; approval has not been granted as of this review.
How does retatrutide differ from semaglutide/tirzepatide?
It adds glucagon-receptor agonism to the GLP-1/GIP dual action of tirzepatide, which in trials produced larger weight loss but also more frequent GI side effects.
Research Citations
Alberto Martínez-Castelao, José Luis Górriz, Beatriz Fernández-Fernández, María José Soler, Juan F Navarro-González (2025)
Riad Mohammed Abdelrahman, Taha Hussein Musa, Ismail Adam Arbab, Mohsen Hussein Suliman, Eltieb Omer Ahmed (2025)
Ehab Takrori, Supriya Peshin, Sakshi Singal (2025)
Rosenstock J, Frias J, Jastreboff AM, Du Y, Lou J, Gurbuz S, Thomas MK, Hartman ML, Haupt A, Milicevic Z, Coskun T (2023)
+ 21 more citations
Related Resources
Quick Facts
Formula
C69H42N6O
Molecular Weight
4889.48
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Mechanism
Triple agonist (GLP-1/GIP/Glucagon) for superior metabolic health and weight loss
Safety Information
Investigational compound in Phase 3 trials. Not yet approved for clinical use.
Citations
26Alberto Martínez-Castelao, José Luis Górriz, Beatriz Fernández-Fernández, María José Soler, Juan F Navarro-González (2025)
Riad Mohammed Abdelrahman, Taha Hussein Musa, Ismail Adam Arbab, Mohsen Hussein Suliman, Eltieb Omer Ahmed (2025)
Ehab Takrori, Supriya Peshin, Sakshi Singal (2025)
Rosenstock J, Frias J, Jastreboff AM, Du Y, Lou J, Gurbuz S, Thomas MK, Hartman ML, Haupt A, Milicevic Z, Coskun T (2023)
+ 21 more citations