The mechano growth factor E-peptide (MGF-E), derived from an IGF-1 isoform, activated human muscle progenitor cells and increased their fusion potential across donor ages.
MGF (Mechano Growth Factor)
Mechano growth factor for muscle tissue repair after exercise

🛑 WADA BANNED - Prohibited in competitive sports as growth factor
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Research compound - IGF-1 splice variant
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Human evidence is observational: muscle biopsy studies show the MGF (IGF-1Ec) splice variant is upregulated in skeletal muscle after resistance exercise and injury. No interventional clinical trials of MGF peptide administration in humans were identified.
Animal work (largely from the Goldspink group) links MGF expression to muscle satellite-cell activation and regenerative responses after mechanical loading and injury.
An in-vitro study with human muscle progenitor cells found that the MGF E-peptide activated these cells and increased their fusion potential, including in cells from older donors.
Benefits of injected MGF or PEG-MGF (muscle growth, recovery) are not supported by clinical trials; PEG-MGF's extended-duration claims lack published human pharmacokinetic data.
Key Studies & Findings
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
200mcg post-workout
Frequently Asked Questions
What is MGF?
Mechano growth factor (IGF-1Ec) is a locally produced splice variant of IGF-1 that rises in skeletal muscle after exercise or injury and is linked to satellite-cell activation.
Is MGF FDA approved?
No. It is an unapproved research peptide.
Does MGF build muscle in humans?
There is no clinical trial evidence that injected MGF builds muscle in humans; the peptide's role is established only as an endogenous, exercise-responsive factor.
Research Citations
Sun H, Yang J, Zhang Z, Wu M, Tian Z, Liu Y, Zhang X, Zhong J, Yang S, Chen Y, Luo J, Guan G, Yin H, Niu Q (2025)
Ning J, Zheng Y, Ren Y, Li L, Shi X, Peng D, Yang Y (2022)
Zhao Y, Zhang S, Cheng B, Feng F, Zhu Y, Liu Y, Wang J, Zou D, Ma H, Xu F, Zhang M (2024)
+ 47 more citations
Related Resources
Quick Facts
Formula
F3Mg-
Molecular Weight
2888.16
Sequence
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Mechanism
Muscle-specific IGF-1 variant for localized muscle repair and growth
Safety Information
Research compound only. Limited human safety data available.
Citations
52Sun H, Yang J, Zhang Z, Wu M, Tian Z, Liu Y, Zhang X, Zhong J, Yang S, Chen Y, Luo J, Guan G, Yin H, Niu Q (2025)
Ning J, Zheng Y, Ren Y, Li L, Shi X, Peng D, Yang Y (2022)
Zhao Y, Zhang S, Cheng B, Feng F, Zhu Y, Liu Y, Wang J, Zou D, Ma H, Xu F, Zhang M (2024)
+ 47 more citations