In a double-blind, placebo-controlled crossover study, the synthetic melanotropic peptide (MT-II) initiated erections in men with psychogenic erectile dysfunction.
Melanotan-II
Melanocortin receptor agonist for tanning and appetite suppression
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Clinical studies of MT-II demonstrated dose-dependent skin tanning in healthy volunteers and initiation of erections in men with psychogenic erectile dysfunction (double-blind, placebo-controlled crossover study). Its metabolite bremelanotide (PT-141) was FDA-approved in 2019 (Vyleesi) for hypoactive sexual desire disorder in premenopausal women; MT-II itself is not FDA-approved.
Rodent studies show MT-II activates melanocortin receptors (MC1R, MC3R, MC4R, MC5R), driving pigmentation, feeding suppression, and erectile responses.
Binding assays characterize MT-II as a potent non-selective agonist of MC1R, MC3R, MC4R, and MC5R.
Consumer use of unapproved MT-II for 'sunless tanning' is widespread but unregulated; long-term melanoma risk and other safety questions remain unverified, and appetite/sexual claims are based on limited clinical work.
Key Studies & Findings
Bremelanotide (PT-141), derived from MT-II, was approved by the FDA for hypoactive sexual desire disorder in premenopausal women.
Benefits & Effects
Increased sexual desire
Weight loss and fat reduction
Tanning/skin pigmentation
Side Effects & Safety
Nausea (12.9% severe at 0.025 mg/kg)
Facial flushing
Yawning
Priapism (case reports)
Mild-Moderate side effect
Onset: 15 min - 2 hours
Management: Symptomatic; dose reduction
Dose-dependent
Mild side effect
Onset: Shortly after
Management: Supportive care
Dose-dependent
Severe side effect
Onset: Within 2 hours
Management: ICU; IV fluids; benzodiazepines
Dose-dependent
Moderate side effect
Onset: 1-2 weeks
Management: Dermatologic exam; discontinue
Dose-dependent
Severe side effect
Onset: Variable
Management: Surgical excision; oncologic follow-up
Moderate side effect
Onset: 1-5 hours
Management: Urologic evaluation if >4 hours
Dose-dependent
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
0.5-1 mg Loading then maintenance
Research Protocols
Initial Loading
- Dose
- 0.25mg
- Frequency
- Daily
- Route
- Subcutaneous
Tanning Maintenance
- Dose
- 0.5-1mg
- Frequency
- 2-3x weekly
- Route
- Subcutaneous
Sexual Enhancement
- Dose
- 0.5-1mg
- Frequency
- As needed
- Route
- Subcutaneous
Minimal Side Effects
- Dose
- 0.1-0.25mg
- Frequency
- Every other day
- Route
- Subcutaneous
Photoprotection
- Dose
- 0.5mg
- Frequency
- 2x weekly
- Route
- Subcutaneous
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is Melanotan II FDA-approved?
No. MT-II itself is not approved. Only its metabolite bremelanotide (PT-141, Vyleesi) is FDA-approved, and only for hypoactive sexual desire disorder in premenopausal women.
Why is Melanotan II used for tanning?
It is a potent agonist of MC1R on melanocytes, which stimulates melanogenesis (tanning) without UV exposure - an off-label use for which it is unapproved and unregulated.
Is Melanotan II safe?
Safety is not established. Reported side effects include nausea, flushing, darkening of existing moles, and spontaneous erections; effects on melanoma risk are unverified. It should not be used outside regulated clinical research.
Research Citations
Related Resources
Quick Facts
Formula
C50H69N15O9
Molecular Weight
1024.0
Sequence
MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
Mechanism
Melanocortin receptor agonist for tanning
Safety Information
⚠️⚠️ ILLEGAL - NOT APPROVED in any jurisdiction. Multiple national health warnings issued. NO SAFE PROTOCOL. Associated with priapism and melanocytic changes.