Triple GLP-1/GIP/glucagon receptor agonist for metabolic optimization
Last reviewed: 2026-08-18
Also known as
Status: Phase 3 Clinical Trials - GLP-1/Glucagon dual agonist
Full composition (formula, molecular weight, sequence) in Quick Facts →
Mazdutide (once-weekly SC) is in advanced clinical development for obesity and type 2 diabetes. A phase 2 trial in 248 Chinese adults with overweight/obesity showed 24-week weight reductions of -6.7% (3 mg), -10.4% (4.5 mg) and -11.3% (6 mg) vs +1.0% placebo. Phase 2 data in Chinese patients with type 2 diabetes showed significant reductions in HbA1c and weight. The GLORY-2 phase 3 trial reported ~20% weight loss with 9 mg mazdutide in Chinese adults with obesity, and a head-to-head phase 3 trial (DREAMS-3) showed superiority over semaglutide for glycemic control and weight loss in T2D/obesity. It received NMPA approval in China (July 2025) for chronic weight management — the first approved dual GCG/GLP-1 receptor agonist — but is not FDA approved.
Dual GCG/GLP-1 receptor agonists reduce body weight and improve metabolism in mouse models, and mazdutide reduced liver fat in metabolic disease models, supporting the dual-agonist rationale.
Mazdutide is a balanced GLP-1 receptor and glucagon receptor agonist engineered as a long-acting, once-weekly peptide (fatty-acid acylated); receptor-activity profiling was established in cell assays.
Long-term cardiovascular outcomes and durability beyond 48 weeks are not yet established; glucagon agonism-related safety (glucose excursions, heart-rate effects) requires continued monitoring. Data are largely from Chinese populations.
Phase 2 trial in 248 Chinese adults with overweight/obesity: 24-week weight loss was -6.7% (3 mg), -10.4% (4.5 mg) and -11.3% (6 mg) vs +1.0% placebo, all statistically significant; most common adverse events were diarrhea, nausea and upper respiratory tract infection.
Phase 3 GLORY-2 trial: 9 mg once-weekly mazdutide produced approximately 20% weight reduction in Chinese adults with obesity at week 48.
Mazdutide received NMPA approval in China (July 2025) for chronic weight management, becoming the first dual GCG/GLP-1 receptor agonist approved for weight management worldwide.
Phase 3 head-to-head trial (DREAMS-3) showed mazdutide was superior to semaglutide for both glycemic control (HbA1c) and weight loss in Chinese adults with type 2 diabetes and obesity (results announced Oct 2025).
Onset: Days
Management: Hydration
Dose-dependent
Onset: Days
Management: Antiemetics
Dose-dependent
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
Under clinical investigation, consult healthcare provider
Research protocols are for educational purposes only. Always consult qualified medical professionals.
It was approved by China's NMPA in July 2025 for chronic weight management. It is not yet FDA approved in the US.
It is a once-weekly dual agonist of the GLP-1 and glucagon receptors, combining appetite suppression with increased energy expenditure and hepatic fat oxidation.
In phase 2, 24-week weight loss ranged from about 7% (3 mg) to 11% (6 mg) vs ~1% placebo; the phase 3 GLORY-2 trial reported ~20% weight loss with 9 mg at 48 weeks.
Yes — it is a long-acting acylated peptide agonist of GLP-1 and glucagon receptors, developed by Innovent Biologics and Eli Lilly (LY3305677).
Ji L, Jiang H, Bi Y, Li H, Tian J, Liu D, Zhao Y, Qiu W, Huang C, Chen L, Zhong S, Han J, Zhang Y, Lian Q, Yang P, Lv L, Gu J, Liu Z, Deng H, Wang Y, Li L, Pei L, Qian L, GLORY-1 Investigators (2025)
Ji L, Jiang H, Cheng Z, Qiu W, Liao L, Zhang Y, Li X, Pang S, Zhang L, Chen L, Yang T, Li Y, Qu S, Wen J, Gu J, Deng H, Wang Y, Li L, Han-Zhang H, Ma Q, Qian L (2023)
Zhang B, Cheng Z, Chen J, Zhang X, Liu D, Jiang H, Ma G, Wang X, Gan S, Sun J, Jin P, Yi J, Shi B, Ma J, Ye S, Wang G, Ji L, Gu X, Yu T, An P, Deng H, Li H, Li L, Ma Q, Qian L, Yang W (2024)
Shirley M (2025)
Ji L, Gao L, Jiang H, Yang J, Yu L, Wen J, Cai C, Deng H, Feng L, Song B, Ma Q, Qian L (2022)
+ 19 more citations
Formula
C207H317N45O65
Molecular Weight
4.5
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Mechanism
Dual receptor agonism targeting both GLP-1 and glucagon pathways
Investigational drug in clinical trials. Not approved for use outside of clinical studies.
Ji L, Jiang H, Bi Y, Li H, Tian J, Liu D, Zhao Y, Qiu W, Huang C, Chen L, Zhong S, Han J, Zhang Y, Lian Q, Yang P, Lv L, Gu J, Liu Z, Deng H, Wang Y, Li L, Pei L, Qian L, GLORY-1 Investigators (2025)
Ji L, Jiang H, Cheng Z, Qiu W, Liao L, Zhang Y, Li X, Pang S, Zhang L, Chen L, Yang T, Li Y, Qu S, Wen J, Gu J, Deng H, Wang Y, Li L, Han-Zhang H, Ma Q, Qian L (2023)
Zhang B, Cheng Z, Chen J, Zhang X, Liu D, Jiang H, Ma G, Wang X, Gan S, Sun J, Jin P, Yi J, Shi B, Ma J, Ye S, Wang G, Ji L, Gu X, Yu T, An P, Deng H, Li H, Li L, Ma Q, Qian L, Yang W (2024)
Shirley M (2025)
Ji L, Gao L, Jiang H, Yang J, Yu L, Wen J, Cai C, Deng H, Feng L, Song B, Ma Q, Qian L (2022)
+ 19 more citations