Skip to main content
4 views

Mazdutide

Triple GLP-1/GIP/glucagon receptor agonist for metabolic optimization

Mazdutide molecular structure

Overview

Mazdutide (IBI362, LY3305677) is an investigational once-weekly long-acting peptide that acts as a dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptors for treatment of obesity and metabolic disorders. The dual mechanism combines GLP-1's effects on insulin secretion, appetite suppression, and gastric emptying with glucagon's ability to increase energy expenditure and hepatic fat oxidation. This triple-pronged approach aims to maximize metabolic benefits while addressing limitations of single-receptor agonists. Clinical trials have demonstrated significant weight loss and improvements in glycemic control. The glucagon receptor agonism may provide additional benefits for liver fat reduction relevant to metabolic dysfunction-associated steatotic liver disease (MASLD). Mazdutide is being developed jointly by Eli Lilly and Innovent Biologics, with advanced clinical development in China. Phase 3 trials are evaluating efficacy for obesity and type 2 diabetes. The compound represents the growing trend toward multi-receptor incretin-based therapies that provide comprehensive metabolic benefits.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

IBI362LY3305677GCG/GLP-1 dual agonistGlucagon/GLP-1 receptor dual agonist

Status: Phase 3 Clinical Trials - GLP-1/Glucagon dual agonist

CAS2259884-03-0
PubChem167312357

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

ObesityType 2 diabetesMASLD / liver fatWeight managementMetabolic disease

Available Evidence

Human

Mazdutide (once-weekly SC) is in advanced clinical development for obesity and type 2 diabetes. A phase 2 trial in 248 Chinese adults with overweight/obesity showed 24-week weight reductions of -6.7% (3 mg), -10.4% (4.5 mg) and -11.3% (6 mg) vs +1.0% placebo. Phase 2 data in Chinese patients with type 2 diabetes showed significant reductions in HbA1c and weight. The GLORY-2 phase 3 trial reported ~20% weight loss with 9 mg mazdutide in Chinese adults with obesity, and a head-to-head phase 3 trial (DREAMS-3) showed superiority over semaglutide for glycemic control and weight loss in T2D/obesity. It received NMPA approval in China (July 2025) for chronic weight management — the first approved dual GCG/GLP-1 receptor agonist — but is not FDA approved.

Animal

Dual GCG/GLP-1 receptor agonists reduce body weight and improve metabolism in mouse models, and mazdutide reduced liver fat in metabolic disease models, supporting the dual-agonist rationale.

In Vitro

Mazdutide is a balanced GLP-1 receptor and glucagon receptor agonist engineered as a long-acting, once-weekly peptide (fatty-acid acylated); receptor-activity profiling was established in cell assays.

Uncertain

Long-term cardiovascular outcomes and durability beyond 48 weeks are not yet established; glucagon agonism-related safety (glucose excursions, heart-rate effects) requires continued monitoring. Data are largely from Chinese populations.

Key Studies & Findings

4 studies
Clinical2025

Mazdutide received NMPA approval in China (July 2025) for chronic weight management, becoming the first dual GCG/GLP-1 receptor agonist approved for weight management worldwide.

Benefits & Effects

5 documented

Weight loss

anecdotal

Blood sugar control

anecdotal

Appetite suppression

anecdotal

Enhanced metabolism

anecdotal

Diabetes management

anecdotal

Side Effects & Safety

5 reported

Mild-Moderate side effect

Very common (36%) Reversible

Onset: Days

Management: Hydration

Dose-dependent

Mild-Moderate side effect

Common (23%) Reversible

Onset: Days

Management: Antiemetics

Dose-dependent

Diarrhea

moderateCommon Reversible

Onset: within days

Decreased appetite

mildCommon Reversible

Onset: within days

Nausea

mildCommon Reversible

Onset: within days

Limitations & Open Questions

Approval and most phase 3 data are from China and Asian populations; FDA approval is pending. Gastrointestinal adverse events are common; long-term safety, cardiovascular outcomes, and durability data are incomplete. The final DREAMS-3 manuscript data should be verified against the published record.

Pharmacology

Mazdutide (IBI362/LY3305677) is a once-weekly, subcutaneously administered, fatty-acid-acylated peptide that agonizes both the glucagon-like peptide-1 receptor and the glucagon receptor. GLP-1 agonism drives appetite suppression and insulinotropic effects; glucagon agonism increases energy expenditure and hepatic fat oxidation. Phase 2 doses ranged 3-6 mg once weekly; higher-dose studies evaluated 9 mg. NMPA-approved in China for chronic weight management.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

Under clinical investigation, consult healthcare provider

Half-life: ~1 week (estimated from class)

Research Protocols

Weight loss initiation (3mg target)

Dose
1.5mg → 3mg
Frequency
Once weekly
Route
SubQ injection

Weight loss progression (4.5mg target)

Dose
1.5mg → 3mg → 4.5mg
Frequency
Once weekly
Route
SubQ injection

Weight loss optimization (6mg target)

Dose
2mg → 4mg → 6mg
Frequency
Once weekly
Route
SubQ injection

Maximum weight loss (9mg target)

Dose
3mg → 6mg → 9mg
Frequency
Once weekly
Route
SubQ injection

T2D management (mild-moderate)

Dose
3-4.5mg weekly
Frequency
Once weekly
Route
SubQ injection

T2D with obesity (intensive)

Dose
6-9mg weekly
Frequency
Once weekly
Route
SubQ injection

Research protocols are for educational purposes only. Always consult qualified medical professionals.

Frequently Asked Questions

Is mazdutide approved?

It was approved by China's NMPA in July 2025 for chronic weight management. It is not yet FDA approved in the US.

How does mazdutide work?

It is a once-weekly dual agonist of the GLP-1 and glucagon receptors, combining appetite suppression with increased energy expenditure and hepatic fat oxidation.

How much weight loss does mazdutide produce?

In phase 2, 24-week weight loss ranged from about 7% (3 mg) to 11% (6 mg) vs ~1% placebo; the phase 3 GLORY-2 trial reported ~20% weight loss with 9 mg at 48 weeks.

Is mazdutide a peptide?

Yes — it is a long-acting acylated peptide agonist of GLP-1 and glucagon receptors, developed by Innovent Biologics and Eli Lilly (LY3305677).

Research Citations

1
Once-Weekly Mazdutide in Chinese Adults with Obesity or Overweight.

Ji L, Jiang H, Bi Y, Li H, Tian J, Liu D, Zhao Y, Qiu W, Huang C, Chen L, Zhong S, Han J, Zhang Y, Lian Q, Yang P, Lv L, Gu J, Liu Z, Deng H, Wang Y, Li L, Pei L, Qian L, GLORY-1 Investigators (2025)

2
A phase 2 randomised controlled trial of mazdutide in Chinese overweight adults or adults with obesity.

Ji L, Jiang H, Cheng Z, Qiu W, Liao L, Zhang Y, Li X, Pang S, Zhang L, Chen L, Yang T, Li Y, Qu S, Wen J, Gu J, Deng H, Wang Y, Li L, Han-Zhang H, Ma Q, Qian L (2023)

3
Efficacy and Safety of Mazdutide in Chinese Patients With Type 2 Diabetes: A Randomized, Double-Blind, Placebo-Controlled Phase 2 Trial.

Zhang B, Cheng Z, Chen J, Zhang X, Liu D, Jiang H, Ma G, Wang X, Gan S, Sun J, Jin P, Yi J, Shi B, Ma J, Ye S, Wang G, Ji L, Gu X, Yu T, An P, Deng H, Li H, Li L, Ma Q, Qian L, Yang W (2024)

4

+ 19 more citations

Related Resources

Quick Facts

Formula

C207H317N45O65

Molecular Weight

4.5

Sequence

MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Mechanism

Dual receptor agonism targeting both GLP-1 and glucagon pathways

Safety Information

Investigational drug in clinical trials. Not approved for use outside of clinical studies.

View All Peptides