In 9,340 patients with type 2 diabetes and high cardiovascular risk, liraglutide reduced the rate of major adverse cardiovascular events versus placebo (LEADER trial).
Liraglutide
GLP-1 agonist for diabetes and weight management

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Liraglutide is FDA approved (Victoza for type 2 diabetes, 2010; Saxenda for chronic weight management, 2014). The LEADER trial (NEJM 2016) showed liraglutide reduced major adverse cardiovascular events in high-risk type 2 diabetes patients; the SCALE trials showed 3.0 mg/day produced meaningful weight loss in adults with obesity; and the phase 2 LEAN trial found liraglutide improved NASH resolution and fibrosis in some patients.
Rodent studies of GLP-1 receptor agonism support effects on appetite, glucose-dependent insulin secretion, and beta-cell function that underlie the clinical profile.
Cell-based studies characterize liraglutide as a potent GLP-1 receptor agonist with ~97% homology to native GLP-1 and albumin-binding-mediated prolongation of action.
Off-label use purely for cosmetic weight loss, and proposed neuroprotective or longevity benefits, remain unproven; benefits depend on continued treatment, with weight regain after discontinuation.
Key Studies & Findings
In the SCALE Obesity and Prediabetes trial, liraglutide 3.0 mg/day produced significantly greater weight loss than placebo in adults with overweight/obesity.
In the phase 2 LEAN trial, liraglutide 1.8 mg/day led to more NASH resolution than placebo in patients with non-alcoholic steatohepatitis.
Benefits & Effects
Side Effects & Safety
Mild-Moderate side effect
Onset: Days
Management: Slow escalation
Dose-dependent
Mild-Moderate side effect
Onset: Days
Management: Hydration
Dose-dependent
Mild side effect
Onset: Weeks
Management: Monitor
Dose-dependent
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
0.6-3.0 mg Daily
Frequently Asked Questions
Is liraglutide the same as semaglutide?
No — both are GLP-1 receptor agonists, but liraglutide is dosed once daily, has ~97% homology to native GLP-1, and is generally less potent for weight loss than semaglutide.
What is liraglutide approved for?
Type 2 diabetes (Victoza) and chronic weight management in adults with obesity, or overweight plus a weight-related comorbidity (Saxenda).
How is liraglutide taken?
By subcutaneous injection once daily, titrated up over several weeks to reduce gastrointestinal side effects.
Research Citations
Pastor R, Tur JA (2019)
Guo T, Yan W, Cui X, Liu N, Wei X, Sun Y, Fan K, Liu J, Zhu Y, Wang Z, Zhang Y, Chen L (2023)
Secher A, Jelsing J, Baquero AF, Hecksher-Sørensen J, Cowley MA, Dalbøge LS, Hansen G, Grove KL, Pyke C, Raun K, Schäffer L, Tang-Christensen M, Verma S, Witgen BM, Vrang N, Bjerre Knudsen L (2014)
Zhang Q, Zhang C, Kang C, Zhu J, He Q, Li H, Tong Q, Wang M, Zhang L, Xiong X, Wang Y, Qu H, Zheng H, Zheng Y (2024)
+ 21 more citations
Related Resources
Quick Facts
Formula
C172H265N43O51
Molecular Weight
3751.20
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Mechanism
GLP-1 receptor agonist for weight loss and diabetes management
Safety Information
FDA approved for diabetes and obesity. Well-established safety profile.
Citations
26Pastor R, Tur JA (2019)
Guo T, Yan W, Cui X, Liu N, Wei X, Sun Y, Fan K, Liu J, Zhu Y, Wang Z, Zhang Y, Chen L (2023)
Secher A, Jelsing J, Baquero AF, Hecksher-Sørensen J, Cowley MA, Dalbøge LS, Hansen G, Grove KL, Pyke C, Raun K, Schäffer L, Tang-Christensen M, Verma S, Witgen BM, Vrang N, Bjerre Knudsen L (2014)
Zhang Q, Zhang C, Kang C, Zhu J, He Q, Li H, Tong Q, Wang M, Zhang L, Xiong X, Wang Y, Qu H, Zheng H, Zheng Y (2024)
+ 21 more citations