Skip to main content
FDA Approved 12 views

Liraglutide

GLP-1 agonist for diabetes and weight management

Liraglutide molecular structure

Overview

Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist with 97% amino acid sequence homology to native human GLP-1, modified with a fatty acid side chain enabling once-daily dosing through albumin binding. FDA-approved as Victoza for type 2 diabetes and Saxenda for chronic weight management, liraglutide works by enhancing glucose-dependent insulin secretion, suppressing glucagon release, slowing gastric emptying, and reducing appetite through central satiety pathways. Clinical trials demonstrate significant improvements in glycemic control (HbA1c reduction), body weight loss, and cardiovascular outcomes. The LEADER trial established cardiovascular safety and showed reduction in major adverse cardiovascular events. Research indicates benefits for non-alcoholic steatohepatitis (NASH) and potential neuroprotective effects. Liraglutide is administered via subcutaneous injection with gradual dose titration to minimize gastrointestinal side effects including nausea. The peptide represented a major advancement in incretin-based therapies and paved the way for newer, more potent GLP-1 receptor agonists.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

VictozaSaxendaNN2211GLP-1 receptor agonist (liraglutide)
CAS204656-20-2
PubChem16134956

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Type 2 diabetes managementObesity and weight managementCardiovascular outcomesNon-alcoholic steatohepatitis (NASH)

Available Evidence

Human

Liraglutide is FDA approved (Victoza for type 2 diabetes, 2010; Saxenda for chronic weight management, 2014). The LEADER trial (NEJM 2016) showed liraglutide reduced major adverse cardiovascular events in high-risk type 2 diabetes patients; the SCALE trials showed 3.0 mg/day produced meaningful weight loss in adults with obesity; and the phase 2 LEAN trial found liraglutide improved NASH resolution and fibrosis in some patients.

Animal

Rodent studies of GLP-1 receptor agonism support effects on appetite, glucose-dependent insulin secretion, and beta-cell function that underlie the clinical profile.

In Vitro

Cell-based studies characterize liraglutide as a potent GLP-1 receptor agonist with ~97% homology to native GLP-1 and albumin-binding-mediated prolongation of action.

Uncertain

Off-label use purely for cosmetic weight loss, and proposed neuroprotective or longevity benefits, remain unproven; benefits depend on continued treatment, with weight regain after discontinuation.

Key Studies & Findings

3 studies
Clinical2015

In the SCALE Obesity and Prediabetes trial, liraglutide 3.0 mg/day produced significantly greater weight loss than placebo in adults with overweight/obesity.

Clinical2016

In the phase 2 LEAN trial, liraglutide 1.8 mg/day led to more NASH resolution than placebo in patients with non-alcoholic steatohepatitis.

Benefits & Effects

5 documented

Proven weight loss

anecdotal

Blood sugar control

anecdotal

Cardiovascular benefits

anecdotal

Appetite reduction

anecdotal

Beta cell preservation

anecdotal

Side Effects & Safety

8 reported

Constipation

MildUncommon

Rare pancreatitis

SevereRare

Diarrhea

MildUncommon

Vomiting

MildUncommon

Nausea

MildUncommon

Mild-Moderate side effect

Mild-ModerateVery common (39-40%) Reversible

Onset: Days

Management: Slow escalation

Dose-dependent

Mild-Moderate side effect

Mild-ModerateCommon (20-21%) Reversible

Onset: Days

Management: Hydration

Dose-dependent

Mild side effect

MildCommon (3-7 bpm) Reversible

Onset: Weeks

Management: Monitor

Dose-dependent

Limitations & Open Questions

Common side effects include nausea, vomiting, and diarrhea, requiring dose titration; increased risks of gallbladder disease and signals for pancreatitis have been reported, and weight is typically regained after stopping. Long-term use in normal-weight individuals for cosmetic purposes has not been studied.

Pharmacology

Once-daily subcutaneous injection; GLP-1 receptor agonist with ~97% sequence homology to native GLP-1, with fatty-acid derivatization enabling albumin binding and a terminal half-life of ~13 hours. Actions include glucose-dependent insulin secretion, glucagon suppression, slowed gastric emptying, and central appetite reduction.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

0.6-3.0 mg Daily

Route: SC
Half-life: ~13 hours

Frequently Asked Questions

Is liraglutide the same as semaglutide?

No — both are GLP-1 receptor agonists, but liraglutide is dosed once daily, has ~97% homology to native GLP-1, and is generally less potent for weight loss than semaglutide.

What is liraglutide approved for?

Type 2 diabetes (Victoza) and chronic weight management in adults with obesity, or overweight plus a weight-related comorbidity (Saxenda).

How is liraglutide taken?

By subcutaneous injection once daily, titrated up over several weeks to reduce gastrointestinal side effects.

Research Citations

4
The arcuate nucleus mediates GLP-1 receptor agonist liraglutide-dependent weight loss.

Secher A, Jelsing J, Baquero AF, Hecksher-Sørensen J, Cowley MA, Dalbøge LS, Hansen G, Grove KL, Pyke C, Raun K, Schäffer L, Tang-Christensen M, Verma S, Witgen BM, Vrang N, Bjerre Knudsen L (2014)

5
Liraglutide Promotes Diabetic Wound Healing via Myo1c/Dock5.

Zhang Q, Zhang C, Kang C, Zhu J, He Q, Li H, Tong Q, Wang M, Zhang L, Xiong X, Wang Y, Qu H, Zheng H, Zheng Y (2024)

+ 21 more citations

Related Resources

Quick Facts

Formula

C172H265N43O51

Molecular Weight

3751.20

Sequence

MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Mechanism

GLP-1 receptor agonist for weight loss and diabetes management

Safety Information

FDA approved for diabetes and obesity. Well-established safety profile.

View All Peptides