FDA-approved label: hCG is indicated for induction of ovulation/pregnancy in anovulatory infertility, prepubertal cryptorchidism, and hypogonadotropic hypogonadism in males.
HCG (Human Chorionic Gonadotropin)
Human chorionic gonadotropin for fertility and testosterone optimization

WADA BANNED - Prohibited in competitive sports except by approved TUE
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: FDA approved
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
hCG is FDA-approved (e.g., Novarel, 1974) for inducing ovulation in infertility, treating prepubertal cryptorchidism, and hypogonadotropic hypogonadism in males; it is widely used in ART to trigger final oocyte maturation and in men to maintain intratesticular testosterone during testosterone therapy. Long-term follow-up studies show hCG alone can induce spermatogenesis in men with isolated hypogonadotropic hypogonadism.
The 'hCG diet' (hCG plus very-low-calorie diet) for weight loss is not supported by evidence - meta-analyses find no additional benefit over calorie restriction alone, and the FDA has required disclaimers on hCG weight-loss products.
Key Studies & Findings
Long-term hCG monotherapy (14-120 months) induced spermatogenesis in men with isolated hypogonadotropic hypogonadism.
A criteria-based meta-analysis of the Simeons 'hCG diet' found no evidence that hCG provides additional weight loss beyond the accompanying very-low-calorie diet.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
250-500IU 2-3x weekly
Research Protocols
TRT Adjunct (Low Dose)
- Dose
- 250-500 IU
- Frequency
- Every other day
- Route
- SubQ or IM
TRT Adjunct (Standard)
- Dose
- 500-1000 IU
- Frequency
- Twice weekly
- Route
- SubQ or IM
HCG Monotherapy (Hypogonadism)
- Dose
- 1500-2000 IU
- Frequency
- 2-3 times weekly
- Route
- IM injection
Fertility Protocol (with FSH)
- Dose
- 1500-2000 IU
- Frequency
- 2-3 times weekly
- Route
- IM injection
Cryptorchidism (Pediatric)
- Dose
- 1000-5000 IU (age-dependent)
- Frequency
- 2-3 times weekly x 3-4 weeks
- Route
- IM injection
Ovulation Trigger (Female)
- Dose
- 5000-10,000 IU single dose
- Frequency
- Once (timed with follicle maturity)
- Route
- IM or SubQ
PCT Protocol
- Dose
- 1000-1500 IU
- Frequency
- Every other day x 2-3 weeks
- Route
- SubQ or IM
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Does hCG work for weight loss?
No. Meta-analyses show no weight-loss benefit beyond the very-low-calorie diet itself; the FDA has required hCG weight-loss products to carry disclaimers that the claim is unsupported.
Why is hCG used alongside testosterone replacement?
Exogenous testosterone suppresses the HPG axis and intratesticular testosterone; hCG maintains Leydig-cell function and spermatogenesis, helping preserve fertility during TRT.
Research Citations
[Human chorionic gonadotropin (hCG) and subunits].
Morita H, Maruo T (2005)
Szczerba A, Białas P, Pięta PP, Jankowska A (2016)
Cole LA (2007)
+ 43 more citations
Related Resources
Quick Facts
Formula
C11H19N3O6S
Molecular Weight
25700.00
Sequence
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Mechanism
Stimulates testosterone production and fertility
Safety Information
FDA approved for fertility and hypogonadism. Established safety profile with medical supervision.
Citations
481.[Human chorionic gonadotropin (hCG) and subunits].
Morita H, Maruo T (2005)
Schumacher A (2017)
Szczerba A, Białas P, Pięta PP, Jankowska A (2016)
Cole LA (2007)
+ 43 more citations