Skip to main content
307 views

Glutathione

Master antioxidant for detoxification and cellular protection

Glutathione molecular structure

Overview

Glutathione (GSH) is a tripeptide consisting of glutamate, cysteine, and glycine that serves as the body's master antioxidant and primary defense against oxidative stress. Present in virtually all cells, glutathione protects against reactive oxygen species, supports detoxification of xenobiotics and metabolic byproducts, maintains other antioxidants (vitamins C and E) in their active forms, and plays essential roles in immune function and DNA synthesis. Research demonstrates glutathione levels decline with age and in numerous disease states including neurodegenerative conditions, liver disease, HIV/AIDS, and cancer. The reduced form (GSH) neutralizes free radicals and is regenerated by glutathione reductase using NADPH. Supplementation strategies include oral glutathione (with variable bioavailability), liposomal glutathione, intravenous glutathione, and precursor support (N-acetyl cysteine, glycine, glutamine). Research indicates benefits for liver protection, skin lightening, immune support, and athletic recovery. Optimal glutathione status is considered fundamental to cellular health and longevity.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

GSHL-glutathionereduced glutathionegamma-glutamylcysteinylglycine

Status: Supplement - Master antioxidant

CAS70-18-8
PubChem124886

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Antioxidant defense and oxidative stressParkinson's diseaseDetoxification researchPsychiatric disorders (adjunctive)Nutritional biochemistry

Available Evidence

Human

An early open study reported clinical benefit from repeated IV reduced glutathione in early Parkinson's disease, though later trials are small and mixed. A 2024 randomized trial found that adding IV glutathione to ketamine therapy improved depression outcomes. Pharmacokinetic studies show oral glutathione is very poorly absorbed, a key limitation for oral supplementation.

Animal

Animal models link glutathione depletion to oxidative injury and show that glutathione or its precursors restore antioxidant capacity in conditions such as acetaminophen toxicity and neurodegeneration models.

In Vitro

Cell and biochemical studies establish glutathione as the major intracellular thiol antioxidant, directly scavenging reactive oxygen species and serving as a cofactor for glutathione peroxidases and transferases.

Uncertain

Consumer claims for oral or IV glutathione - skin lightening, 'detox', anti-aging, immune boosting - are not supported by robust clinical evidence; oral bioavailability is poor and IV use for these purposes is not FDA approved.

Key Studies & Findings

3 studies

Benefits & Effects

18 documented

Master antioxidant

Detoxifies liver

Improves skin health

Reduces oxidative stress.

Master antioxidant

Detoxifies liver

Improves skin health

Reduces oxidative stress.

There may be some absorption of glutathione intact from the intestines, but it cannot enter cells intact. It must be metabolized to form L-cystine (two molecules of L-cysteine bound together) before being taken up.

clinical

Provision of L-cysteine within the cell is all that is needed to increase glutathione synthesis, and N-Acetylcysteine does this efficiently at a lower financial cost than glutathione.

clinical

In effect, glutathione is an indirect and expensive way to provide dietary L-cysteine. Dietary protein itself, including L-cysteine rich sources such as Whey Protein, are effective but inefficient ways to increase L-cysteine intake in the diet and N-Acetylcysteine is both more efficient and cheaper than glutathione.

clinical

Although oral glutathione supplementation does not efficiently increase intracellular glutathione levels for the above reasons, it can be absorbed intact into the blood stream. Since increased glutathione levels in the blood have been shown to slow the breakdown of nitric oxide, glutathione supplementation may be useful to augment nitric oxide boosters such as L-Citrulline or L-Arginine.

clinical

Antioxidant support

anecdotal

Immune health

anecdotal

Detoxification

anecdotal

Cellular protection

anecdotal

Anti-aging effects

anecdotal

Liver support

anecdotal

Side Effects & Safety

4 reported

Side effect reported

Well-tolerated

Management: No intervention

GI discomfort (oral)

mildUncommon Reversible

Onset: within hours

Bloating

mildRare Reversible

Onset: within hours

Skin whitening (high doses)

mildRare Reversible

Onset: weeks

Limitations & Open Questions

Human evidence for therapeutic glutathione use is thin: most trials are small, open-label or adjunctive, and results are mixed. Oral absorption is negligible, IV formulations are not FDA approved for the marketed wellness indications, and long-term safety data for repeated IV administration are lacking.

Pharmacology

Glutathione is a ubiquitous intracellular tripeptide (gamma-Glu-Cys-Gly) and the body's main endogenous antioxidant. As a supplement it is given orally (very poorly absorbed), intravenously, or by inhalation in various unapproved protocols; the IV route bypasses the low oral bioavailability demonstrated in pharmacokinetic studies.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

Supplement protocols: 250-1000mg daily (consult healthcare provider)

Half-life: 1.6-5 hours (oral); longer with liposomal

Research Protocols

General antioxidant support

Dose
200-400 mg
Frequency
1-2x weekly
Route
IM or IV push

Detoxification support

Dose
400-600 mg
Frequency
2-3x weekly
Route
IV push or slow infusion

Immune support

Dose
400-600 mg
Frequency
1-2x weekly
Route
IV or IM

Neurological support (Parkinson's research)

Dose
1400 mg
Frequency
3x weekly
Route
IV infusion (clinical protocol)

Maintenance

Dose
200 mg
Frequency
1x weekly
Route
IM or SubQ

Research protocols are for educational purposes only. Always consult qualified medical professionals.

Frequently Asked Questions

Does oral glutathione work?

Evidence shows oral glutathione is very poorly absorbed (low systemic bioavailability), so most oral products are unlikely to meaningfully raise plasma glutathione.

Is IV glutathione FDA approved?

IV glutathione is not FDA approved for skin lightening, detox, or anti-aging uses; approved indications for glutathione-related products are limited.

What is the Parkinson's disease evidence?

An early open study (1996) reported benefit from IV glutathione in early Parkinson's disease; subsequent trials are small and mixed, so it is not an established treatment.

Research Citations

5

Hepatic glutathione and glutathione S-conjugate transport mechanisms.

Lee TK, Li L, Ballatori N (1997)

+ 20 more citations

Related Resources

Quick Facts

Formula

C10H17N3O6S

Molecular Weight

0.307

Sequence

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Mechanism

Master antioxidant that neutralizes free radicals and supports detoxification

Safety Information

Generally considered safe as a supplement. Consult healthcare provider for appropriate dosing.

View All Peptides