Skip to main content
WADA Banned 12 views

Follistatin

Follistatin molecular structure

WADA BANNED - Prohibited in competitive sports as myostatin inhibitor

Overview

Follistatin is a naturally occurring glycoprotein that functions as a potent inhibitor of myostatin and other members of the transforming growth factor-beta (TGF-β) superfamily including activins. By neutralizing myostatin—the primary negative regulator of skeletal muscle growth—follistatin effectively removes the biological brake on muscle development. Research demonstrates that follistatin overexpression or administration leads to significant increases in muscle mass and strength in animal models. The protein also influences reproductive physiology, inflammation, and metabolic processes through its effects on activins. Different follistatin isoforms (FS288, FS303, FS315) have varying tissue distributions and binding characteristics. Gene therapy approaches using follistatin have entered clinical trials for muscular dystrophies, showing improved muscle function and ambulation. Research continues exploring follistatin's potential for muscle wasting conditions, sarcopenia, and age-related muscle loss. The protein's effects extend beyond muscle to include roles in wound healing and fibrosis modulation.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

FSTFollistatin-344FS344Activin-binding proteinMyostatin inhibitor

Status: Research compound - Myostatin inhibitor

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Muscular dystrophy gene therapyMuscle growth / myostatin inhibitionSporadic inclusion body myositisSarcopeniaFibrosis modulation

Available Evidence

Human

A phase 1/2a trial of AAV1-delivered follistatin (FS344) injected intramuscularly into the quadriceps of 6 Becker muscular dystrophy patients reported increased muscle strength on some measures; two cohort-1 patients improved 6-minute walk distance by 58 m and 125 m. A follow-up gene therapy trial in sporadic inclusion body myositis (9 patients) reported improved functional outcomes including 6-minute walk test.

Animal

Extensive preclinical studies showed AAV-delivered follistatin increases muscle strength and mass in mice, and follistatin overexpression blocks myostatin/activin signaling that normally limits muscle growth.

In Vitro

Follistatin binds and neutralizes myostatin and activins of the TGF-beta superfamily; FS344 (the alternatively spliced isoform used in the clinic) was chosen to avoid off-target binding sites.

Uncertain

Follistatin use as an injected peptide for physique or anti-aging purposes has no clinical evidence; the only human data come from gene-therapy delivery in muscle disease. Long-term safety of chronic follistatin exposure is unknown, and it is banned by WADA.

Key Studies & Findings

3 studies

Benefits & Effects

6 documented

Muscle growth

anecdotal

Strength enhancement

anecdotal

Myostatin inhibition

anecdotal

Lean mass increase

anecdotal

Athletic performance

anecdotal

Body composition

anecdotal

Side Effects & Safety

3 reported

Unknown long-term effects in humans

MildUncommon

Potential muscle/tendon imbalance

MildUncommon

Limited safety data

MildUncommon

Limitations & Open Questions

The only human evidence is from small, open-label, non-randomized gene-therapy trials in rare muscle diseases; effects were variable and no randomized placebo-controlled trial exists. There is no evidence supporting follistatin peptide injections for muscle gain in healthy people. WADA bans follistatin in sport.

Pharmacology

Follistatin is a naturally occurring glycoprotein that binds and neutralizes myostatin and activins (TGF-beta superfamily). In clinical gene-therapy trials, the FS344 isoform was delivered via AAV1 by direct intramuscular injection into the quadriceps (dose 3x10^11 vg/kg/leg in cohort 1). The peptide itself has a short plasma half-life, which is why trials used gene delivery rather than peptide injections.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

Variable Protocol-dependent

Route: Gene therapy
Half-life: Variable

Research Protocols

Research Protocol (Anecdotal)

Dose
100 mcg
Frequency
Once daily
Route
SubQ

Higher Dose Protocol (Anecdotal)

Dose
200 mcg
Frequency
Once daily (max recommended)
Route
SubQ

Research protocols are for educational purposes only. Always consult qualified medical professionals.

Frequently Asked Questions

Is follistatin an approved treatment for muscular dystrophy?

No. Follistatin gene therapy has been tested in small phase 1/2a trials in Becker muscular dystrophy and sporadic inclusion body myositis, but it is not approved by any regulator.

Does injected follistatin build muscle in healthy people?

There is no published clinical evidence for follistatin peptide injections increasing muscle mass in healthy people; the human data come from AAV gene therapy in muscle disease patients.

Why is follistatin banned in sport?

WADA prohibits follistatin because it is a potent myostatin inhibitor and is viewed as a gene-doping / performance-enhancing agent.

Research Citations

Related Resources

Quick Facts

Molecular Weight

36000.00

Sequence

MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Mechanism

Myostatin inhibitor for muscle growth

Safety Information

Research compound only. Very limited human safety data available.

View All Peptides