AAV1.CMV.FS344 injected bilaterally into quadriceps of 6 Becker muscular dystrophy patients was safe; two cohort-1 patients improved 6-minute walk distance by 58 m and 125 m with other strength measures also improving.
Follistatin

WADA BANNED - Prohibited in competitive sports as myostatin inhibitor
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Research compound - Myostatin inhibitor
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
A phase 1/2a trial of AAV1-delivered follistatin (FS344) injected intramuscularly into the quadriceps of 6 Becker muscular dystrophy patients reported increased muscle strength on some measures; two cohort-1 patients improved 6-minute walk distance by 58 m and 125 m. A follow-up gene therapy trial in sporadic inclusion body myositis (9 patients) reported improved functional outcomes including 6-minute walk test.
Extensive preclinical studies showed AAV-delivered follistatin increases muscle strength and mass in mice, and follistatin overexpression blocks myostatin/activin signaling that normally limits muscle growth.
Follistatin binds and neutralizes myostatin and activins of the TGF-beta superfamily; FS344 (the alternatively spliced isoform used in the clinic) was chosen to avoid off-target binding sites.
Follistatin use as an injected peptide for physique or anti-aging purposes has no clinical evidence; the only human data come from gene-therapy delivery in muscle disease. Long-term safety of chronic follistatin exposure is unknown, and it is banned by WADA.
Key Studies & Findings
AAV1-follistatin gene therapy in 9 patients with sporadic inclusion body myositis improved functional outcomes, including 6-minute walk test performance.
Preclinical studies demonstrated AAV-delivered follistatin inhibits myostatin signaling and increases muscle strength in animal models of muscular dystrophy.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
Variable Protocol-dependent
Research Protocols
Research Protocol (Anecdotal)
- Dose
- 100 mcg
- Frequency
- Once daily
- Route
- SubQ
Higher Dose Protocol (Anecdotal)
- Dose
- 200 mcg
- Frequency
- Once daily (max recommended)
- Route
- SubQ
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is follistatin an approved treatment for muscular dystrophy?
No. Follistatin gene therapy has been tested in small phase 1/2a trials in Becker muscular dystrophy and sporadic inclusion body myositis, but it is not approved by any regulator.
Does injected follistatin build muscle in healthy people?
There is no published clinical evidence for follistatin peptide injections increasing muscle mass in healthy people; the human data come from AAV gene therapy in muscle disease patients.
Why is follistatin banned in sport?
WADA prohibits follistatin because it is a potent myostatin inhibitor and is viewed as a gene-doping / performance-enhancing agent.
Research Citations
Patel K (1998)
Bielka W, Przezak A, Pawlik A (2023)
Hansen JS, Plomgaard P (2016)
+ 22 more citations
Related Resources
Quick Facts
Molecular Weight
36000.00
Sequence
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Mechanism
Myostatin inhibitor for muscle growth
Safety Information
Research compound only. Very limited human safety data available.
Citations
27Patel K (1998)
Bielka W, Przezak A, Pawlik A (2023)
Hansen JS, Plomgaard P (2016)
+ 22 more citations