Randomized trial found that reflexology combined with neuroprotective treatment (including Cortexin) improved outcomes in children with the hemiparetic form of cerebral palsy.
Cortexin
Brain peptide complex for neuroprotection and cognitive enhancement
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Cortexin is a registered drug in Russia and several former-USSR countries. Small randomized trials (mostly Russian-language) report benefit as part of rehabilitation in children with cerebral palsy and as a neuroprotective adjunct; large Western-standard trials are lacking.
Preclinical studies report neuroprotective, antioxidant and neurotrophic-like effects in animal models of brain injury.
Mechanism of action is poorly characterized (heterogeneous peptide mixture); English-language evidence is sparse and dosing regimens vary by local practice.
Key Studies & Findings
Randomized study reported changes in brain electrical activity in children with cerebral palsy during complex rehabilitation including Cortexin.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
10-20mg per day, 5-10 days
Frequently Asked Questions
Is Cortexin FDA-approved?
No. It is registered as a pharmaceutical in Russia and some other countries, but not approved by the FDA.
What is Cortexin made of?
A complex of low-molecular-weight polypeptides extracted from mammalian brain cortex tissue.
Research Citations
Yazar U, Ayar A (2023)
Guven C, Türk A, Koçak S, Zencirci B, Yalcin A, Aydın H, Doğukan M (2025)
[Influence of cortexin on memory and attention].
Tsyganov VN, Bogoslovskiĭ MM (2004)
+ 21 more citations
Related Resources
Quick Facts
Molecular Weight
2.3
Sequence
MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEGLEKGQFDHALA
Mechanism
Neuroprotective brain peptide complex for cognitive enhancement
Safety Information
Approved in Russia for neurological conditions. NOT FDA approved. Research compound elsewhere.
Citations
26Yazar U, Ayar A (2023)
Guven C, Türk A, Koçak S, Zencirci B, Yalcin A, Aydın H, Doğukan M (2025)
5.[Influence of cortexin on memory and attention].
Tsyganov VN, Bogoslovskiĭ MM (2004)
+ 21 more citations