Skip to main content
22 views

Copper Peptides

Copper Peptides molecular structure

Overview

Copper Peptides are small protein fragments that bind tightly to copper ions, with GHK-Cu being the most famous and well-researched. Your body naturally produces these peptides, but levels decline significantly as you age. **Why copper matters:** Copper is essential for enzymes involved in wound healing, collagen production, and antioxidant defense. Copper peptides deliver this copper directly to tissues while also sending "repair" signals to cells. **What the research shows:** • Stimulate collagen and elastin production for firmer skin • Accelerate wound healing across multiple tissue types • Reduce inflammation and oxidative damage • Can modify expression of over 4,000 genes toward healthier patterns • Support hair follicle health and growth **Where you'll find them:** Widely used in anti-aging skincare serums and creams, wound care products, and hair growth treatments. Available in topical and injectable forms. **Age-related decline:** GHK-Cu levels drop from about 200 ng/mL at age 20 to around 80 ng/mL by age 60. This decline may contribute to slower healing and visible skin aging. **Popular forms:** • GHK-Cu: The most researched copper peptide • AHK-Cu: A variant with an alanine substitution --- **Sources:** Pickart L, et al. (2015) Oxidative Medicine and Cellular Longevity. DOI:10.1155/2015/648108 | Pickart L, et al. (2008) Journal of Biomaterials Science. DOI:10.1163/156856208784909435

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

GHK-Cucopper tripeptide-1Cu-GHKglycyl-L-histidyl-L-lysine copper(II) complexCopper Peptide GHK-Cu
CAS130120-56-8
PubChem23978

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Skin aging and anti-agingWound healingCollagen and elastin productionHair growthTissue remodeling

Available Evidence

Human

Small human studies report improved collagen production and skin appearance with topical GHK-Cu; a Phase 2 trial of a topical GHK-Cu gel for acute skin wound healing is currently recruiting (NCT07437586). Most mechanistic support comes from in-vitro and gene-expression work rather than large randomized trials.

Animal

In-vivo skin and wound models in rodents show that GHK-Cu accelerates wound healing, increases angiogenesis and promotes collagen deposition.

In Vitro

GHK-Cu stimulates collagen and elastin synthesis in cultured fibroblasts, modulates MMP/TIMP expression, and regulates the expression of a large number of genes relevant to tissue remodeling and inflammation (review: Pickart & Margolina, Int J Mol Sci 2018).

Uncertain

Claims of systemic anti-aging, oral, or injectable copper-peptide benefits are not supported by published clinical evidence; most human data concern topical application, and the best-known review literature is authored by the peptide's pioneer (L. Pickart).

Key Studies & Findings

2 studies

Benefits & Effects

5 documented

Collagen synthesis stimulation

anecdotalSkin Health

Wound healing acceleration

anecdotalHealing

Anti-inflammatory effects

anecdotalAnti-inflammatory

Hair growth support

anecdotalHair

Antioxidant protection

anecdotalLongevity

Side Effects & Safety

3 reported

Mild skin irritation

mildRare Reversible

Onset: immediate

Allergic reaction

mildRare Reversible

Onset: within days

Injection site reactions (SC)

mildUncommon Reversible

Onset: immediate

Limitations & Open Questions

Human clinical evidence is limited and heterogeneous: many studies are small, short-term, or uncontrolled, and there are no large randomized controlled trials for cosmetic outcomes; systemic uses are unstudied in humans.

Pharmacology

GHK is a naturally occurring human tripeptide (glycyl-histidyl-lysine) found in plasma and tissues; it binds copper(II) to form GHK-Cu. Topical application is the best-studied route; mechanistic effects include upregulation of collagen/elastin synthesis and modulation of matrix metalloproteinases.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

0.5%-2%, 1-2 times per day

Route: Topical/SC
Half-life: Minutes to hours (varies by application)

Frequently Asked Questions

Does GHK-Cu really increase collagen in human skin?

Small human studies and in-vitro work suggest increased collagen production with topical use, but large, high-quality randomized trials are still lacking.

Is GHK-Cu approved for cosmetic or medical use?

It is widely used in cosmetic formulations, but it is not an FDA-approved drug; the Phase 2 wound-healing trial (NCT07437586) is still recruiting.

Research Citations

Related Resources

Quick Facts

Formula

C14H24CuN6O4

Molecular Weight

403.9

Sequence

MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV

Mechanism

Promotes collagen production and wound healing

Safety Information

Research compound. ⚠️ ANGIOGENESIS CONCERN - Avoid with cancer history. Generally well-tolerated topically. 🛑 WADA BANNED

View All Peptides