Review summarizing GHK-Cu's gene-regulatory and regenerative actions: increased collagen and elastin synthesis, antioxidant and anti-inflammatory effects, and tissue-remodeling activity.
Copper Peptides

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Small human studies report improved collagen production and skin appearance with topical GHK-Cu; a Phase 2 trial of a topical GHK-Cu gel for acute skin wound healing is currently recruiting (NCT07437586). Most mechanistic support comes from in-vitro and gene-expression work rather than large randomized trials.
In-vivo skin and wound models in rodents show that GHK-Cu accelerates wound healing, increases angiogenesis and promotes collagen deposition.
GHK-Cu stimulates collagen and elastin synthesis in cultured fibroblasts, modulates MMP/TIMP expression, and regulates the expression of a large number of genes relevant to tissue remodeling and inflammation (review: Pickart & Margolina, Int J Mol Sci 2018).
Claims of systemic anti-aging, oral, or injectable copper-peptide benefits are not supported by published clinical evidence; most human data concern topical application, and the best-known review literature is authored by the peptide's pioneer (L. Pickart).
Key Studies & Findings
Phase 2 trial registered and recruiting for topical GHK-Cu gel in acute skin wound healing (sponsor: Hudson Biotech).
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
0.5%-2%, 1-2 times per day
Frequently Asked Questions
Does GHK-Cu really increase collagen in human skin?
Small human studies and in-vitro work suggest increased collagen production with topical use, but large, high-quality randomized trials are still lacking.
Is GHK-Cu approved for cosmetic or medical use?
It is widely used in cosmetic formulations, but it is not an FDA-approved drug; the Phase 2 wound-healing trial (NCT07437586) is still recruiting.
Research Citations
Begum SZ, Nizam NSM, Muhamad A, Saiman MI, Crouse KA, Abdul Rahman MB (2020)
+ 32 more citations
Related Resources
Quick Facts
Formula
C14H24CuN6O4
Molecular Weight
403.9
Sequence
MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Mechanism
Promotes collagen production and wound healing
Safety Information
Research compound. ⚠️ ANGIOGENESIS CONCERN - Avoid with cancer history. Generally well-tolerated topically. 🛑 WADA BANNED
Citations
37Begum SZ, Nizam NSM, Muhamad A, Saiman MI, Crouse KA, Abdul Rahman MB (2020)
+ 32 more citations