Skip to main content
WADA Banned 37 views

AICAR

AMPK activator for endurance enhancement and metabolic optimization

AICAR molecular structure

WADA BANNED - Prohibited in competitive sports as metabolic modulator

Overview

AICAR (5-Aminoimidazole-4-carboxamide ribonucleoside, Acadesine) is an adenosine analog that activates AMP-activated protein kinase (AMPK), a master regulator of cellular energy homeostasis. AMPK activation mimics many metabolic effects of exercise, leading to AICAR's classification as an "exercise mimetic." Research demonstrates AICAR enhances fat oxidation, improves glucose uptake in skeletal muscle, increases mitochondrial biogenesis, and enhances endurance capacity. Studies in mice showed 44% improvement in running endurance without exercise training. The compound activates AMPK by being converted to ZMP, which mimics the effects of elevated AMP levels. Beyond metabolic effects, AMPK activation influences autophagy, inflammation, and cellular stress responses. Research indicates potential applications for obesity, type 2 diabetes, metabolic syndrome, and conditions of physical deconditioning. AICAR was initially developed for cardiac ischemia protection and has cardioprotective properties. The compound is prohibited by WADA in competitive sports due to its performance-enhancing effects.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

AICARAcadesine5-Aminoimidazole-4-carboxamide ribonucleosideAICA ribosideAICA-riboside

Status: Research compound - AMPK activator

CAS3031-94-5
PubChem65110

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Exercise mimetics / AMPK signalingMetabolic health (glucose uptake, fatty-acid oxidation)Myocardial ischemia-reperfusion injuryMitochondrial biogenesis / endurance

Available Evidence

Human

Acadesine was studied in clinical trials as an adenosine-regulating agent to protect the heart during coronary artery bypass grafting; the randomized RED-CABG trial (JAMA 2012) showed no benefit on morbidity/mortality, and acadesine was never approved.

Animal

In sedentary mice, AICAR combined with the PPARδ agonist GW1516 increased running endurance by ~44% without training, the landmark 'exercise mimetic' finding (Narkar et al., Cell 2008); AICAR also increases skeletal-muscle glucose uptake and mitochondrial content in rodent models.

In Vitro

AICAR is phosphorylated intracellularly to ZMP, an AMP analog that allosterically activates AMPK; in cultured muscle cells it enhances glucose uptake and fatty-acid oxidation.

Uncertain

Claims that AICAR delivers human performance or endurance benefits are speculative — human trials targeted cardiac ischemia, not performance, and failed; oral use is not evidence-based.

Key Studies & Findings

3 studies
Preclinical2008

AICAR plus a PPARδ agonist increased running endurance ~44% in sedentary mice without exercise training, establishing AMPK activation as an exercise-mimetic pathway.

Clinical2012

The RED-CABG randomized trial found the adenosine-regulating agent acadesine had no significant effect on morbidity or mortality after coronary artery bypass grafting.

Benefits & Effects

6 documented

Enhanced endurance

anecdotal

Metabolic efficiency

anecdotal

Fat oxidation

anecdotal

Glucose uptake

anecdotal

Mitochondrial biogenesis

anecdotal

Exercise mimetic effects

anecdotal

Side Effects & Safety

4 reported

Rare cardiac effects

SevereRare

Nausea

MildUncommon

Headache

MildUncommon

Fatigue

MildUncommon

Limitations & Open Questions

Human data come from failed cardiac-surgery trials and pharmacokinetic studies, not performance research. No human trial supports endurance, fat-loss, or muscle claims, and the oral bioavailability and dosing used by consumers are uncharacterized in humans.

Pharmacology

A purine nucleoside analog that is phosphorylated to ZMP, an AMP mimetic that activates AMPK. Clinical studies administered it intravenously with a short plasma half-life; oral use is not supported by human pharmacokinetic data.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

50-500mg IV/SC

Route: IV/SC
Half-life: 2 hours

Frequently Asked Questions

Is AICAR (acadesine) approved for human use?

No. It is not FDA-approved for any indication; clinical development for cardiac surgery was discontinued after trials showed no benefit.

Does AICAR actually mimic exercise in humans?

The exercise-mimetic effect is documented in mice (Narkar et al., 2008). No human study has demonstrated endurance or performance benefits.

Research Citations

1
Purine Nucleotide Precursors in Preventing Myocardial Ischemia-Reperfusion Injury.

Pawel Tomasz Musial, Piotr Arkadiusz Badtke, Magdalena Agnieszka Zabielska-Kaczorowska (2025)

+ 24 more citations

Related Resources

Quick Facts

Formula

C9H14N4O5

Molecular Weight

258.23

Sequence

MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH

Mechanism

AMPK activator for endurance and metabolic benefits

Safety Information

Research compound only. Limited human safety data available.

View All Peptides